Lineage for d5szfl1 (5szf L:1-107)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (877 PDB entries)
  8. 2293763Domain d5szfl1: 5szf L:1-107 [337064]
    Other proteins in same PDB: d5szfl2
    automated match to d1kegl1
    complexed with so4

Details for d5szfl1

PDB Entry: 5szf (more details), 2.52 Å

PDB Description: 2a10 fab fragment 2.54 angstoms
PDB Compounds: (L:) 2A10 antibody FAB fragment light chain

SCOPe Domain Sequences for d5szfl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5szfl1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqttsslsaslgdrvtiscsasqgisnylnwyqqkpdgtvkllifytstlysgvps
rfsgsgsgtdysltisnlepediatyycqqysrfpyvfgggtkleik

SCOPe Domain Coordinates for d5szfl1:

Click to download the PDB-style file with coordinates for d5szfl1.
(The format of our PDB-style files is described here.)

Timeline for d5szfl1:

  • d5szfl1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27