SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ohgb1 (5ohg B:1-140)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170927Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2170928Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2171206Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2171207Protein automated matches [226922] (86 species)
    not a true protein
  7. 2293729Species Escherichia coli [TaxId:83333] [337030] (1 PDB entry)
  8. 2293761Domain d5ohgb1: 5ohg B:1-140 [337062]
    Other proteins in same PDB: d5ohga2, d5ohgb2, d5ohgh2, d5ohgi2
    automated match to d2fyma2
    complexed with mg, na, po4

Details for d5ohgb1

PDB Entry: 5ohg (more details), 2 Å

PDB Description: enolase in complex with rnase e
PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d5ohgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ohgb1 d.54.1.0 (B:1-140) automated matches {Escherichia coli [TaxId: 83333]}
mskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrfl
gkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanak
aaaaakgmplyehiaelngt

SCOPe Domain Coordinates for d5ohgb1:

Click to download the PDB-style file with coordinates for d5ohgb1.
(The format of our PDB-style files is described here.)

Timeline for d5ohgb1:

  • d5ohgb1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27