SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5n8fa2 (5n8f A:167-340)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2036241Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2036242Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2036937Family b.6.1.3: Multidomain cupredoxins [49550] (8 protein domains)
  6. 2037154Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 2037155Species Achromobacter cycloclastes [TaxId:223] [49552] (25 PDB entries)
  8. 2293760Domain d5n8fa2: 5n8f A:167-340 [337061]
    automated match to d2bw4a2
    complexed with cu, so4

Details for d5n8fa2

PDB Entry: 5n8f (more details), 1.38 Å

PDB Description: serial cu nitrite reductase structures at elevated cryogenic temperature, 240k. dataset 1.
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d5n8fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n8fa2 b.6.1.3 (A:167-340) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm

SCOPe Domain Coordinates for d5n8fa2:

Click to download the PDB-style file with coordinates for d5n8fa2.
(The format of our PDB-style files is described here.)

Timeline for d5n8fa2:

  • d5n8fa2 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5n8fa1