![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
![]() | Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) part of Klenow fragment, KF |
![]() | Species Thermus aquaticus [TaxId:271] [53121] (29 PDB entries) |
![]() | Domain d4ktqa1: 4ktq A:294-422 [33706] Other proteins in same PDB: d4ktqa2 protein/DNA complex |
PDB Entry: 4ktq (more details), 2.5 Å
SCOPe Domain Sequences for d4ktqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ktqa1 c.55.3.5 (A:294-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus [TaxId: 271]} leeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkearglla kdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserlf anlwgrleg
Timeline for d4ktqa1: