SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5nf6b_ (5nf6 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (136 species)
    not a true protein
  7. 2145930Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (100 PDB entries)
  8. 2293758Domain d5nf6b_: 5nf6 B: [337059]
    automated match to d3u92a_
    complexed with 8vn, act, cl, gol, zn

Details for d5nf6b_

PDB Entry: 5nf6 (more details), 2.55 Å

PDB Description: structure of gluk3 ligand-binding domain (s1s2) in complex with cip-as at 2.55 a resolution
PDB Compounds: (B:) Glutamate receptor ionotropic, kainate 3,Glutamate receptor ionotropic, kainate 3

SCOPe Domain Sequences for d5nf6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nf6b_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rslivttlleepfvmfrksdrtlygndrfegycidllkelahilgfsyeirlvedgkyga
qddkgqwngmvkelidhkadlavapltithvrekaidfskpfmtlgvsilyrkgtpidsa
ddlakqtkieygavkdgatmtffkkskistfekmwafmsskpsalvknneegiqrtltad
yallmesttieyitqrncnltqigglidskgygigtpmgspyrdkitiailqlqeedklh
imkekwwrgsgc

SCOPe Domain Coordinates for d5nf6b_:

Click to download the PDB-style file with coordinates for d5nf6b_.
(The format of our PDB-style files is described here.)

Timeline for d5nf6b_:

  • d5nf6b_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27