SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5oeha1 (5oeh A:1-231)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007216Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2007217Family a.118.7.1: 14-3-3 protein [48446] (5 protein domains)
  6. 2007267Protein automated matches [190238] (8 species)
    not a true protein
  7. 2007276Species Human (Homo sapiens) [TaxId:9606] [187008] (41 PDB entries)
  8. 2293754Domain d5oeha1: 5oeh A:1-231 [337055]
    Other proteins in same PDB: d5oeha2
    automated match to d2o98a_
    complexed with 9sz, cl, gol

Details for d5oeha1

PDB Entry: 5oeh (more details), 2.35 Å

PDB Description: molecular tweezers modulate 14-3-3 protein-protein interactions.
PDB Compounds: (A:) 14-3-3 protein sigma

SCOPe Domain Sequences for d5oeha1:

Sequence, based on SEQRES records: (download)

>d5oeha1 a.118.7.1 (A:1-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
vlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfy
lkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfh
yeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

Sequence, based on observed residues (ATOM records): (download)

>d5oeha1 a.118.7.1 (A:1-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
vlssieqksnkgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkmkgd
yyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyeians
peeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

SCOPe Domain Coordinates for d5oeha1:

Click to download the PDB-style file with coordinates for d5oeha1.
(The format of our PDB-style files is described here.)

Timeline for d5oeha1:

  • d5oeha1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5oeha2