Lineage for d5ohgh1 (5ohg H:1-140)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170927Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2170928Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2171206Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2171207Protein automated matches [226922] (87 species)
    not a true protein
  7. 2293729Species Escherichia coli [TaxId:83333] [337030] (1 PDB entry)
  8. 2293751Domain d5ohgh1: 5ohg H:1-140 [337052]
    Other proteins in same PDB: d5ohga2, d5ohgb2, d5ohgh2, d5ohgi2
    automated match to d2fyma2
    complexed with mg, na, po4

Details for d5ohgh1

PDB Entry: 5ohg (more details), 2 Å

PDB Description: enolase in complex with rnase e
PDB Compounds: (H:) enolase

SCOPe Domain Sequences for d5ohgh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ohgh1 d.54.1.0 (H:1-140) automated matches {Escherichia coli [TaxId: 83333]}
mskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrfl
gkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanak
aaaaakgmplyehiaelngt

SCOPe Domain Coordinates for d5ohgh1:

Click to download the PDB-style file with coordinates for d5ohgh1.
(The format of our PDB-style files is described here.)

Timeline for d5ohgh1:

  • d5ohgh1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27