SCOPe 2.08: Domain d5ohgh1: 5ohg H:1-140

Lineage for d5ohgh1 (5ohg H:1-140)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [337030] (1 PDB entry)

8. Domain d5ohgh1: 5ohg H:1-140 [337052]
   Other proteins in same PDB: d5ohga2, d5ohgb2, d5ohgh2, d5ohgi2
   automated match to d2fyma2
   complexed with mg, na, po4

Details for d5ohgh1

PDB Entry: 5ohg, 2 Å

PDB Description: enolase in complex with rnase e

PDB Compounds: (H:) enolase

SCOPe Domain Sequences for d5ohgh1:

Sequence; same for both SEQRES and ATOM records:

>d5ohgh1 d.54.1.0 (H:1-140) automated matches {Escherichia coli [TaxId: 83333]}
mskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrfl
gkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanak
aaaaakgmplyehiaelngt

Timeline for d5ohgh1:

• d5ohgh1 first appeared in SCOPe 2.06
  
• d5ohgh1 appears in SCOPe 2.07