SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gnhb2 (5gnh B:199-586)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116598Family c.45.1.3: Myotubularin-like phosphatases [102422] (2 protein domains)
    common fold is decorated with additional structures
  6. 2116599Protein Myotubularin-related protein 2, C-terminal domain [102423] (1 species)
  7. 2116600Species Human (Homo sapiens) [TaxId:9606] [102424] (5 PDB entries)
  8. 2293750Domain d5gnhb2: 5gnh B:199-586 [337051]
    Other proteins in same PDB: d5gnha1, d5gnhb1
    automated match to d1zvra2
    complexed with po4

Details for d5gnhb2

PDB Entry: 5gnh (more details), 2.6 Å

PDB Description: myotubularin-related protein 2
PDB Compounds: (B:) Myotubularin-related protein 2

SCOPe Domain Sequences for d5gnhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gnhb2 c.45.1.3 (B:199-586) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
evfpengwklydplleyrrqgipneswritkineryelcdtypallvvpanipdeelkrv
asfrsrgripvlswihpesqatitrcsqpmvgvsgkrskedekylqaimdsnaqshkifi
fdarpsvnavankakgggyesedayqnaelvfldihnihvmreslrklkeivypnieeth
wlsnlesthwlehiklilagalriadkvesgktsvvvhssdgwdrtaqltslamlmldgy
yrtirgfevlvekewlsfghrfqlrvghgdknhadadrspvflqfidcvwqmtrqfptaf
efneyflitildhlysclfgtflcnseqqrgkenlpkrtvslwsyinsqledftnplygs
ysnhvlypvasmrhlelwvgyyirwnpr

SCOPe Domain Coordinates for d5gnhb2:

Click to download the PDB-style file with coordinates for d5gnhb2.
(The format of our PDB-style files is described here.)

Timeline for d5gnhb2:

  • d5gnhb2 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5gnhb1