SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ohga2 (5ohg A:141-431)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2086988Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2086989Family c.1.11.1: Enolase [51605] (2 protein domains)
    automatically mapped to Pfam PF00113
  6. 2087073Protein automated matches [226973] (6 species)
    not a true protein
  7. 2293731Species Escherichia coli [TaxId:83333] [337032] (1 PDB entry)
  8. 2293735Domain d5ohga2: 5ohg A:141-431 [337036]
    Other proteins in same PDB: d5ohga1, d5ohgb1, d5ohgh1, d5ohgi1
    automated match to d2fymc1
    complexed with mg, na, po4

Details for d5ohga2

PDB Entry: 5ohg (more details), 2 Å

PDB Description: enolase in complex with rnase e
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d5ohga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ohga2 c.1.11.1 (A:141-431) automated matches {Escherichia coli [TaxId: 83333]}
pgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvkeairmgsevfhhlakvlkak
gmntavgdeggyapnlgsnaealaviaeavkaagyelgkditlamdcaasefykdgkyvl
agegnkaftseefthfleeltkqypivsiedgldesdwdgfayqtkvlgdkiqlvgddlf
vtntkilkegiekgiansilikfnqigsltetlaaikmakdagytavishrsgetedati
adlavgtaagqiktgsmsrsdrvakynqlirieealgekapyngrkeikgq

SCOPe Domain Coordinates for d5ohga2:

Click to download the PDB-style file with coordinates for d5ohga2.
(The format of our PDB-style files is described here.)

Timeline for d5ohga2:

  • d5ohga2 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27