Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) consists of one domain of this fold |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (10 proteins) contains Pfam 00929 |
Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) part of Klenow fragment, KF |
Species Thermus aquaticus [TaxId:271] [53121] (13 PDB entries) |
Domain d1ktq_1: 1ktq 290-422 [33703] Other proteins in same PDB: d1ktq_2 |
PDB Entry: 1ktq (more details), 2.5 Å
SCOP Domain Sequences for d1ktq_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ktq_1 c.55.3.5 (290-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus} spkaleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkear gllakdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraals erlfanlwgrleg
Timeline for d1ktq_1: