Lineage for d5niha1 (5nih A:3-262)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2145191Protein automated matches [190140] (30 species)
    not a true protein
  7. 2145284Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (37 PDB entries)
  8. 2293725Domain d5niha1: 5nih A:3-262 [337026]
    Other proteins in same PDB: d5niha2
    automated match to d5ftia_
    complexed with 8ve, act, cl, gol, so4

Details for d5niha1

PDB Entry: 5nih (more details), 1.3 Å

PDB Description: crystal structure of the glua2 ligand-binding domain (s1s2j) in complex with agonist lm-12b at 1.3 a resolution.
PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d5niha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5niha1 c.94.1.1 (A:3-262) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln
eqglldklknkwwydkgecg

SCOPe Domain Coordinates for d5niha1:

Click to download the PDB-style file with coordinates for d5niha1.
(The format of our PDB-style files is described here.)

Timeline for d5niha1:

  • d5niha1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5niha2
View in 3D
Domains from other chains:
(mouse over for more information)
d5nihb_