SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5n9wb_ (5n9w B:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222543Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2222544Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2222620Family e.23.1.0: automated matches [191594] (1 protein)
    not a true family
  6. 2222621Protein automated matches [191083] (22 species)
    not a true protein
  7. 2222726Species Streptomyces sp. [TaxId:1931] [256140] (7 PDB entries)
  8. 2293720Domain d5n9wb_: 5n9w B: [337021]
    automated match to d3dhva_
    complexed with act

Details for d5n9wb_

PDB Entry: 5n9w (more details), 2.46 Å

PDB Description: structure of adenylation domain thr1 involved in the biosynthesis of 4-chlorothreonine in streptomyces sp.oh-5093, apo structure
PDB Compounds: (B:) adenylation domain

SCOPe Domain Sequences for d5n9wb_:

Sequence, based on SEQRES records: (download)

>d5n9wb_ e.23.1.0 (B:) automated matches {Streptomyces sp. [TaxId: 1931]}
efgatlvdlfsraamempdrtalhiddekisygllhswaegladllhdagvrkgdrvalr
mppganaiaamlgilragaayvpldirnpparnafivtdsqvvalvgdpgdipeytgplv
teenvaalrdreaikdpgperpgpqdvayiiytsgttgrpkgvpvrhgnvtalfeacsrl
fsfsaddrwllfhsmafdfsvweiwgalstgaelvvlpywtartpvetarvvrdrgitvl
nqtptafgalttavlgegidlpelryvvfggekltpavvrpwakrfgldrphlinmygit
ettvhatfhrlteddlaaedsvigrplpgfthrivtedgrdaatgepgelwlagpqvseg
ylnrpeltaerfttgpardggapppryyhsgdlvsrraggdlvyqgradlqvklrghrie
lsdveaavrthpavvdavvwvhefapgdsrlvcaytaqaseegtgpdaralrahvktvlp
symqpsqylalpelprtingkadrasvarafderr

Sequence, based on observed residues (ATOM records): (download)

>d5n9wb_ e.23.1.0 (B:) automated matches {Streptomyces sp. [TaxId: 1931]}
efgatlvdlfsraamempdrtalhikisygllhswaegladllhdagvrkgdrvalrmpp
ganaiaamlgilragaayvpldirnpparnafivtdsqvvalvgdpggplvteenvaalr
perpgpqdvayiiytsgttgrpkgvpvrhgnvtalfeacsrlfsfsaddrwllfhsmafd
fsvweiwgalstgaelvvlptpvetarvvrdrgitvlnqtptafgalttavlgegidlpe
lryvvfggekltpavvrpwakrfgldrphlinmygitettvhatfhrlteddlaaedsvi
grplpgfthrivtedgrdaatgepgelwlagpqvsegylnrpeltaerfttgpryyhsgd
lvsrraggdlvyqgradlqvklrghrielsdveaavrthpavvdavvwvhefapgdsrlv
caytaqgpdaralrahvktvlpsymqpsqylalpelprtingkadrasvarafderr

SCOPe Domain Coordinates for d5n9wb_:

Click to download the PDB-style file with coordinates for d5n9wb_.
(The format of our PDB-style files is described here.)

Timeline for d5n9wb_:

  • d5n9wb_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27