Lineage for d5nvna1 (5nvn A:52-224)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182898Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2182899Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2182952Family d.86.1.0: automated matches [191459] (1 protein)
    not a true family
  6. 2182953Protein automated matches [190708] (8 species)
    not a true protein
  7. 2182969Species Human (Homo sapiens) [TaxId:9606] [187914] (7 PDB entries)
  8. 2293715Domain d5nvna1: 5nvn A:52-224 [337016]
    Other proteins in same PDB: d5nvna2, d5nvnc2
    automated match to d2jgba_
    complexed with fmt

Details for d5nvna1

PDB Entry: 5nvn (more details), 1.9 Å

PDB Description: crystal structure of the human 4ehp-4e-bp1 complex
PDB Compounds: (A:) eukaryotic translation initiation factor 4e type 2

SCOPe Domain Sequences for d5nvna1:

Sequence, based on SEQRES records: (download)

>d5nvna1 d.86.1.0 (A:52-224) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aehplqynytfwysrrtpgrptssqsyeqnikqigtfasveqfwrfyshmvrpgdltghs
dfhlfkegikpmweddanknggkwiirlrkglasrcwenlilamlgeqfmvgeeicgavv
svrfqediisiwnktasdqattarirdtlrrvlnlppntimeykthtdsikmp

Sequence, based on observed residues (ATOM records): (download)

>d5nvna1 d.86.1.0 (A:52-224) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aehplqynytfwysrnikqigtfasveqfwrfyshmvrpgdltghsdfhlfkegikpmwe
ddanknggkwiirlrkglasrcwenlilamlgeqfmvgeeicgavvsvrfqediisiwnk
tasdqattarirdtlrrvlnlppntimeykthtdsikmp

SCOPe Domain Coordinates for d5nvna1:

Click to download the PDB-style file with coordinates for d5nvna1.
(The format of our PDB-style files is described here.)

Timeline for d5nvna1:

  • d5nvna1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5nvna2