SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5neba1 (5neb A:2-256)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (136 species)
    not a true protein
  7. 2145930Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (100 PDB entries)
  8. 2293710Domain d5neba1: 5neb A:2-256 [337011]
    Other proteins in same PDB: d5neba2, d5nebb2
    automated match to d4mf3a_
    complexed with 8ve, act, cl, gol, so4

Details for d5neba1

PDB Entry: 5neb (more details), 2.05 Å

PDB Description: structure of gluk1 ligand-binding domain (s1s2) in complex with lm-12b at 2.05 a resolution
PDB Compounds: (A:) Glutamate receptor ionotropic, kainate 1

SCOPe Domain Sequences for d5neba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5neba1 c.94.1.0 (A:2-256) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
anrtlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgky
gaqndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtpid
saddlakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrvl
ttdyallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeeg
klhmmkekwwrgngc

SCOPe Domain Coordinates for d5neba1:

Click to download the PDB-style file with coordinates for d5neba1.
(The format of our PDB-style files is described here.)

Timeline for d5neba1:

  • d5neba1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5neba2