Lineage for d5n8ha2 (5n8h A:167-340)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2036241Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2036242Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2036937Family b.6.1.3: Multidomain cupredoxins [49550] (8 protein domains)
  6. 2037154Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 2037155Species Achromobacter cycloclastes [TaxId:223] [49552] (25 PDB entries)
  8. 2293709Domain d5n8ha2: 5n8h A:167-340 [337010]
    automated match to d2bw4a2
    complexed with cu, so4

Details for d5n8ha2

PDB Entry: 5n8h (more details), 1.65 Å

PDB Description: serial cu nitrite reductase structures at elevated cryogenic temperature, 240k. dataset 3.
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d5n8ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n8ha2 b.6.1.3 (A:167-340) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm

SCOPe Domain Coordinates for d5n8ha2:

Click to download the PDB-style file with coordinates for d5n8ha2.
(The format of our PDB-style files is described here.)

Timeline for d5n8ha2:

  • d5n8ha2 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5n8ha1