SCOPe 2.06: Domain d5nvlc1: 5nvl C:52-218

Lineage for d5nvlc1 (5nvl C:52-218)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.86: eIF4e-like [55417] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478

4. Superfamily d.86.1: eIF4e-like [55418] (3 families)

5. Family d.86.1.0: automated matches [191459] (1 protein)
   not a true family

6. Protein automated matches [190708] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187914] (7 PDB entries)

8. Domain d5nvlc1: 5nvl C:52-218 [337004]
   Other proteins in same PDB: d5nvla2, d5nvlc2
   automated match to d2jgba_

Details for d5nvlc1

PDB Entry: 5nvl, 2.3 Å

PDB Description: crystal structure of the human 4ehp-gigyf2 complex

PDB Compounds: (C:) eukaryotic translation initiation factor 4e type 2

SCOPe Domain Sequences for d5nvlc1:

Sequence, based on SEQRES records:

>d5nvlc1 d.86.1.0 (C:52-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aehplqynytfwysrrtpgrptssqsyeqnikqigtfasveqfwrfyshmvrpgdltghs
dfhlfkegikpmweddanknggkwiirlrkglasrcwenlilamlgeqfmvgeeicgavv
svrfqediisiwnktasdqattarirdtlrrvlnlppntimeyktht

Sequence, based on observed residues (ATOM records):

>d5nvlc1 d.86.1.0 (C:52-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aehplqynytfwysrrtnikqigtfasveqfwrfyshmvrpgdltghsdfhlfkegikpm
weddanknggkwiirlrkglasrcwenlilamlgeqfmvgeeicgavvsvrfqediisiw
nktasdqattarirdtlrrvlnlppntimeyktht

Timeline for d5nvlc1:

• d5nvlc1 is new in SCOPe 2.06-stable
  
• d5nvlc1 appears in SCOPe 2.07
  
• d5nvlc1 appears in the current release, SCOPe 2.08