SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5nvnc1 (5nvn C:52-224)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182898Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2182899Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2182952Family d.86.1.0: automated matches [191459] (1 protein)
    not a true family
  6. 2182953Protein automated matches [190708] (7 species)
    not a true protein
  7. 2182969Species Human (Homo sapiens) [TaxId:9606] [187914] (7 PDB entries)
  8. 2293697Domain d5nvnc1: 5nvn C:52-224 [336998]
    Other proteins in same PDB: d5nvna2, d5nvnc2
    automated match to d2jgba_
    complexed with fmt

Details for d5nvnc1

PDB Entry: 5nvn (more details), 1.9 Å

PDB Description: crystal structure of the human 4ehp-4e-bp1 complex
PDB Compounds: (C:) eukaryotic translation initiation factor 4e type 2

SCOPe Domain Sequences for d5nvnc1:

Sequence, based on SEQRES records: (download)

>d5nvnc1 d.86.1.0 (C:52-224) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aehplqynytfwysrrtpgrptssqsyeqnikqigtfasveqfwrfyshmvrpgdltghs
dfhlfkegikpmweddanknggkwiirlrkglasrcwenlilamlgeqfmvgeeicgavv
svrfqediisiwnktasdqattarirdtlrrvlnlppntimeykthtdsikmp

Sequence, based on observed residues (ATOM records): (download)

>d5nvnc1 d.86.1.0 (C:52-224) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aehplqynytfwysrrnikqigtfasveqfwrfyshmvrpgdltghsdfhlfkegikpmw
eddanknggkwiirlrkglasrcwenlilamlgeqfmvgeeicgavvsvrfqediisiwn
ktasdqattarirdtlrrvlnlppntimeykthtdsikmp

SCOPe Domain Coordinates for d5nvnc1:

Click to download the PDB-style file with coordinates for d5nvnc1.
(The format of our PDB-style files is described here.)

Timeline for d5nvnc1:

  • d5nvnc1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5nvnc2