SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5go0a_ (5go0 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2159468Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2159469Protein automated matches [190233] (21 species)
    not a true protein
  7. 2293695Species Trypanosoma brucei [TaxId:185431] [336996] (1 PDB entry)
  8. 2293696Domain d5go0a_: 5go0 A: [336997]
    automated match to d2lrwa_

Details for d5go0a_

PDB Entry: 5go0 (more details)

PDB Description: solution structure of nedd8 from trypanosoma brucei
PDB Compounds: (A:) Ubiquitin, putative

SCOPe Domain Sequences for d5go0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5go0a_ d.15.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 185431]}
mllkvktvsnkviqitsltddntiaelkgkleesegipgnmirlvyqgkqledekrlkdy
qmsagatfhmvvalragc

SCOPe Domain Coordinates for d5go0a_:

Click to download the PDB-style file with coordinates for d5go0a_.
(The format of our PDB-style files is described here.)

Timeline for d5go0a_:

  • d5go0a_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27