Lineage for d5go0a_ (5go0 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933592Species Trypanosoma brucei [TaxId:185431] [336996] (2 PDB entries)
  8. 2933593Domain d5go0a_: 5go0 A: [336997]
    automated match to d2lrwa_

Details for d5go0a_

PDB Entry: 5go0 (more details)

PDB Description: solution structure of nedd8 from trypanosoma brucei
PDB Compounds: (A:) Ubiquitin, putative

SCOPe Domain Sequences for d5go0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5go0a_ d.15.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 185431]}
mllkvktvsnkviqitsltddntiaelkgkleesegipgnmirlvyqgkqledekrlkdy
qmsagatfhmvvalragc

SCOPe Domain Coordinates for d5go0a_:

Click to download the PDB-style file with coordinates for d5go0a_.
(The format of our PDB-style files is described here.)

Timeline for d5go0a_: