Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Trypanosoma brucei [TaxId:185431] [336996] (2 PDB entries) |
Domain d5go0a_: 5go0 A: [336997] automated match to d2lrwa_ |
PDB Entry: 5go0 (more details)
SCOPe Domain Sequences for d5go0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5go0a_ d.15.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 185431]} mllkvktvsnkviqitsltddntiaelkgkleesegipgnmirlvyqgkqledekrlkdy qmsagatfhmvvalragc
Timeline for d5go0a_: