SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mxua1 (5mxu A:6-273)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2200326Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2200327Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2200328Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (8 protein domains)
  6. 2200398Protein automated matches [254445] (3 species)
    not a true protein
  7. 2293688Species Penicillium simplicissimum [TaxId:69488] [336989] (2 PDB entries)
  8. 2293692Domain d5mxua1: 5mxu A:6-273 [336993]
    Other proteins in same PDB: d5mxua2, d5mxub2
    automated match to d1qlta2
    complexed with fad, gol; mutant

Details for d5mxua1

PDB Entry: 5mxu (more details), 2.8 Å

PDB Description: structure of the y503f mutant of vanillyl alcohol oxidase
PDB Compounds: (A:) vanillyl-alcohol oxidase

SCOPe Domain Sequences for d5mxua1:

Sequence, based on SEQRES records: (download)

>d5mxua1 d.145.1.1 (A:6-273) automated matches {Penicillium simplicissimum [TaxId: 69488]}
efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
fgpyidglfsqsnmgivtkigiwlmpnp

Sequence, based on observed residues (ATOM records): (download)

>d5mxua1 d.145.1.1 (A:6-273) automated matches {Penicillium simplicissimum [TaxId: 69488]}
efrpltlppklslsdfnefiqdiirivgsenvevisskivdgsymkpththdphhvmdqd
yflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgknm
nrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergvgy
tpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpygfg
pyidglfsqsnmgivtkigiwlmpnp

SCOPe Domain Coordinates for d5mxua1:

Click to download the PDB-style file with coordinates for d5mxua1.
(The format of our PDB-style files is described here.)

Timeline for d5mxua1:

  • d5mxua1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5mxua2