Lineage for d5mxua1 (5mxu A:6-273)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2200326Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2200327Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2200328Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (8 protein domains)
  6. 2200398Protein automated matches [254445] (3 species)
    not a true protein
  7. 2293688Species Penicillium simplicissimum [TaxId:69488] [336989] (2 PDB entries)
  8. 2293692Domain d5mxua1: 5mxu A:6-273 [336993]
    Other proteins in same PDB: d5mxua2, d5mxub2
    automated match to d1qlta2
    complexed with fad, gol; mutant

Details for d5mxua1

PDB Entry: 5mxu (more details), 2.8 Å

PDB Description: structure of the y503f mutant of vanillyl alcohol oxidase
PDB Compounds: (A:) vanillyl-alcohol oxidase

SCOPe Domain Sequences for d5mxua1:

Sequence, based on SEQRES records: (download)

>d5mxua1 d.145.1.1 (A:6-273) automated matches {Penicillium simplicissimum [TaxId: 69488]}
efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
fgpyidglfsqsnmgivtkigiwlmpnp

Sequence, based on observed residues (ATOM records): (download)

>d5mxua1 d.145.1.1 (A:6-273) automated matches {Penicillium simplicissimum [TaxId: 69488]}
efrpltlppklslsdfnefiqdiirivgsenvevisskivdgsymkpththdphhvmdqd
yflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgknm
nrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergvgy
tpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpygfg
pyidglfsqsnmgivtkigiwlmpnp

SCOPe Domain Coordinates for d5mxua1:

Click to download the PDB-style file with coordinates for d5mxua1.
(The format of our PDB-style files is described here.)

Timeline for d5mxua1:

  • d5mxua1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5mxua2