SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mxja2 (5mxj A:274-560)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2177253Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) (S)
    duplication: contains two subdomains of this fold
  5. 2177254Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (3 protein domains)
    automatically mapped to Pfam PF02913
  6. 2177295Protein automated matches [254446] (2 species)
    not a true protein
  7. 2293690Species Penicillium simplicissimum [TaxId:69488] [336991] (2 PDB entries)
  8. 2293691Domain d5mxja2: 5mxj A:274-560 [336992]
    Other proteins in same PDB: d5mxja1, d5mxjb1
    automated match to d1vaoa1
    complexed with fad, gol; mutant

Details for d5mxja2

PDB Entry: 5mxj (more details), 2.8 Å

PDB Description: structure of the y108f mutant of vanillyl alcohol oxidase
PDB Compounds: (A:) vanillyl-alcohol oxidase

SCOPe Domain Sequences for d5mxja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mxja2 d.58.32.1 (A:274-560) automated matches {Penicillium simplicissimum [TaxId: 69488]}
rgyqsylitlpkdgdlkqavdiirplrlgmalqnvptirhilldaavlgdkrsyssrtep
lsdeeldkiakqlnlgrwnfygalygpepirrvlwetikdafsaipgvkfyfpedtpens
vlrvrdktmqgiptydelkwidwlpngahlffspiakvsgedammqyavtkkrcqeagld
figtftvgmremhhivcivfnkkdliqkrkvqwlmrtliddcaangwgeyrthlafmdqi
metynwnnssflrfnevlknavdpngiiapgksgvwpsqyshvtwkl

SCOPe Domain Coordinates for d5mxja2:

Click to download the PDB-style file with coordinates for d5mxja2.
(The format of our PDB-style files is described here.)

Timeline for d5mxja2:

  • d5mxja2 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5mxja1