Lineage for d1bgxt3 (1bgx T:290-422)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2494311Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2494503Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 2494568Species Thermus aquaticus [TaxId:271] [53121] (29 PDB entries)
  8. 2494584Domain d1bgxt3: 1bgx T:290-422 [33699]
    Other proteins in same PDB: d1bgxh1, d1bgxh2, d1bgxl1, d1bgxl2, d1bgxt1, d1bgxt2, d1bgxt4
    protein/DNA complex

Details for d1bgxt3

PDB Entry: 1bgx (more details), 2.3 Å

PDB Description: taq polymerase in complex with tp7, an inhibitory fab
PDB Compounds: (T:) taq DNA polymerase

SCOPe Domain Sequences for d1bgxt3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgxt3 c.55.3.5 (T:290-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus [TaxId: 271]}
spkaleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkear
gllakdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraals
erlfanlwgrleg

SCOPe Domain Coordinates for d1bgxt3:

Click to download the PDB-style file with coordinates for d1bgxt3.
(The format of our PDB-style files is described here.)

Timeline for d1bgxt3: