SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5nvma1 (5nvm A:52-221)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182898Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2182899Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2182952Family d.86.1.0: automated matches [191459] (1 protein)
    not a true family
  6. 2182953Protein automated matches [190708] (7 species)
    not a true protein
  7. 2182969Species Human (Homo sapiens) [TaxId:9606] [187914] (7 PDB entries)
  8. 2293686Domain d5nvma1: 5nvm A:52-221 [336987]
    Other proteins in same PDB: d5nvma2, d5nvmc2
    automated match to d2jgba_
    complexed with po4

Details for d5nvma1

PDB Entry: 5nvm (more details), 2 Å

PDB Description: crystal structure of the human 4ehp-gigyf2 complex lacking the auxiliary sequences
PDB Compounds: (A:) eukaryotic translation initiation factor 4e type 2

SCOPe Domain Sequences for d5nvma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nvma1 d.86.1.0 (A:52-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aehplqynytfwysrrtpgrptssqsyeqnikqigtfasveqfwrfyshmvrpgdltghs
dfhlfkegikpmweddanknggkwiirlrkglasrcwenlilamlgeqfmvgeeicgavv
svrfqediisiwnktasdqattarirdtlrrvlnlppntimeykthtdsi

SCOPe Domain Coordinates for d5nvma1:

Click to download the PDB-style file with coordinates for d5nvma1.
(The format of our PDB-style files is described here.)

Timeline for d5nvma1:

  • d5nvma1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5nvma2