SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5nihb_ (5nih B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2145191Protein automated matches [190140] (26 species)
    not a true protein
  7. 2145284Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (36 PDB entries)
  8. 2293685Domain d5nihb_: 5nih B: [336986]
    Other proteins in same PDB: d5niha2
    automated match to d5ftia_
    complexed with 8ve, act, cl, gol, so4

Details for d5nihb_

PDB Entry: 5nih (more details), 1.3 Å

PDB Description: crystal structure of the glua2 ligand-binding domain (s1s2j) in complex with agonist lm-12b at 1.3 a resolution.
PDB Compounds: (B:) Glutamate receptor 2

SCOPe Domain Sequences for d5nihb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nihb_ c.94.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgecgs

SCOPe Domain Coordinates for d5nihb_:

Click to download the PDB-style file with coordinates for d5nihb_.
(The format of our PDB-style files is described here.)

Timeline for d5nihb_:

  • d5nihb_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27