SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5n2ca_ (5n2c A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180205Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2181206Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 2181232Family d.79.7.0: automated matches [195454] (1 protein)
    not a true family
  6. 2181233Protein automated matches [195455] (10 species)
    not a true protein
  7. 2293680Species Burkholderia cenocepacia [TaxId:216591] [336981] (1 PDB entry)
  8. 2293683Domain d5n2ca_: 5n2c A: [336984]
    automated match to d4b5cb_
    complexed with act, cxs, edo, oxl

Details for d5n2ca_

PDB Entry: 5n2c (more details), 1.8 Å

PDB Description: crystal structure of the peptidoglycan-associated lipoprotein from burkholderia cenocepacia
PDB Compounds: (A:) putative ompa family lipoprotein

SCOPe Domain Sequences for d5n2ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n2ca_ d.79.7.0 (A:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
dplndpnsplakrsiyfdfdsysvkdeyqplmqqhaqylkshpqrhvliqgntdergtse
ynlalgqkraeavrramallgvndsqmeavslgkekpqatghdeaswaqnrradlvyqq

SCOPe Domain Coordinates for d5n2ca_:

Click to download the PDB-style file with coordinates for d5n2ca_.
(The format of our PDB-style files is described here.)

Timeline for d5n2ca_:

  • d5n2ca_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27