SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ku6a_ (5ku6 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2067964Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2067965Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2067966Family b.74.1.1: Carbonic anhydrase [51070] (2 protein domains)
    automatically mapped to Pfam PF00194
  6. 2067967Protein Carbonic anhydrase [51071] (10 species)
  7. 2068582Species Human (Homo sapiens), isozyme IV [TaxId:9606] [51076] (9 PDB entries)
  8. 2293682Domain d5ku6a_: 5ku6 A: [336983]
    automated match to d1znca_
    complexed with act, gol, mzm, so4, zn

Details for d5ku6a_

PDB Entry: 5ku6 (more details), 1.8 Å

PDB Description: crystal structure for the complex of human carbonic anhydrase iv and methazolamide
PDB Compounds: (A:) Carbonic anhydrase 4

SCOPe Domain Sequences for d5ku6a_:

Sequence, based on SEQRES records: (download)

>d5ku6a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]}
aeshwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkk
qtwtvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfame
mhivhekekgtsrnvkeaqdpedeiavlaflveagtqvnegfqplvealsnipkpemstt
maesslldllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyy
dkeqtvsmkdnvrplqqlgqrtviks

Sequence, based on observed residues (ATOM records): (download)

>d5ku6a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]}
aeshwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkk
qtwtvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfame
mhivhekekgtsdpedeiavlaflveagtqvnegfqplvealsnipkpemsttmaessll
dllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyydkeqtvs
mkdnvrplqqlgqrtviks

SCOPe Domain Coordinates for d5ku6a_:

Click to download the PDB-style file with coordinates for d5ku6a_.
(The format of our PDB-style files is described here.)

Timeline for d5ku6a_:

  • d5ku6a_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27