Lineage for d5ku6a_ (5ku6 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2067964Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2067965Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2067966Family b.74.1.1: Carbonic anhydrase [51070] (2 protein domains)
    automatically mapped to Pfam PF00194
  6. 2067967Protein Carbonic anhydrase [51071] (10 species)
  7. 2068582Species Human (Homo sapiens), isozyme IV [TaxId:9606] [51076] (9 PDB entries)
  8. 2293682Domain d5ku6a_: 5ku6 A: [336983]
    automated match to d1znca_
    complexed with act, gol, mzm, so4, zn

Details for d5ku6a_

PDB Entry: 5ku6 (more details), 1.8 Å

PDB Description: crystal structure for the complex of human carbonic anhydrase iv and methazolamide
PDB Compounds: (A:) Carbonic anhydrase 4

SCOPe Domain Sequences for d5ku6a_:

Sequence, based on SEQRES records: (download)

>d5ku6a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]}
aeshwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkk
qtwtvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfame
mhivhekekgtsrnvkeaqdpedeiavlaflveagtqvnegfqplvealsnipkpemstt
maesslldllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyy
dkeqtvsmkdnvrplqqlgqrtviks

Sequence, based on observed residues (ATOM records): (download)

>d5ku6a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]}
aeshwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkk
qtwtvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfame
mhivhekekgtsdpedeiavlaflveagtqvnegfqplvealsnipkpemsttmaessll
dllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyydkeqtvs
mkdnvrplqqlgqrtviks

SCOPe Domain Coordinates for d5ku6a_:

Click to download the PDB-style file with coordinates for d5ku6a_.
(The format of our PDB-style files is described here.)

Timeline for d5ku6a_:

  • d5ku6a_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27