Lineage for d5n2cb_ (5n2c B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960608Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 2960634Family d.79.7.0: automated matches [195454] (1 protein)
    not a true family
  6. 2960635Protein automated matches [195455] (14 species)
    not a true protein
  7. 2960683Species Burkholderia cenocepacia [TaxId:216591] [336981] (2 PDB entries)
  8. 2960685Domain d5n2cb_: 5n2c B: [336982]
    automated match to d4b5cb_
    complexed with act, cxs, edo, oxl

Details for d5n2cb_

PDB Entry: 5n2c (more details), 1.8 Å

PDB Description: crystal structure of the peptidoglycan-associated lipoprotein from burkholderia cenocepacia
PDB Compounds: (B:) putative ompa family lipoprotein

SCOPe Domain Sequences for d5n2cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n2cb_ d.79.7.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
dplndpnsplakrsiyfdfdsysvkdeyqplmqqhaqylkshpqrhvliqgntdergtse
ynlalgqkraeavrramallgvndsqmeavslgkekpqatghdeaswaqnrradlvyqq

SCOPe Domain Coordinates for d5n2cb_:

Click to download the PDB-style file with coordinates for d5n2cb_.
(The format of our PDB-style files is described here.)

Timeline for d5n2cb_: