SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kzla_ (5kzl A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011416Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2011417Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2011656Family a.132.1.0: automated matches [191333] (1 protein)
    not a true family
  6. 2011657Protein automated matches [190172] (9 species)
    not a true protein
  7. 2293676Species Leptospira interrogans [TaxId:173] [336977] (1 PDB entry)
  8. 2293677Domain d5kzla_: 5kzl A: [336978]
    automated match to d1ni6c_
    complexed with hem

Details for d5kzla_

PDB Entry: 5kzl (more details), 1.73 Å

PDB Description: structure of heme oxygenase from leptospira interrogans
PDB Compounds: (A:) Heme oxygenase

SCOPe Domain Sequences for d5kzla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kzla_ a.132.1.0 (A:) automated matches {Leptospira interrogans [TaxId: 173]}
mslatilregtseehkaaessafirsfmkgilekgtyarhleafyyvyesmeeelernkn
nlvlksiyfpelyrknalledlqffygtwkpndhqpsvatqdyvqrirkisetqpellaa
hsyvrylgdlsggqilkkvaaralnlpegkgisfyefpmiqdingfkqnyrtaldslpvn
dsekqsilaeskqvfllnqgifsel

SCOPe Domain Coordinates for d5kzla_:

Click to download the PDB-style file with coordinates for d5kzla_.
(The format of our PDB-style files is described here.)

Timeline for d5kzla_:

  • d5kzla_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27