Lineage for d5kzla_ (5kzl A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011416Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2011417Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2011656Family a.132.1.0: automated matches [191333] (1 protein)
    not a true family
  6. 2011657Protein automated matches [190172] (9 species)
    not a true protein
  7. 2293676Species Leptospira interrogans [TaxId:173] [336977] (1 PDB entry)
  8. 2293677Domain d5kzla_: 5kzl A: [336978]
    automated match to d1ni6c_
    complexed with hem

Details for d5kzla_

PDB Entry: 5kzl (more details), 1.73 Å

PDB Description: structure of heme oxygenase from leptospira interrogans
PDB Compounds: (A:) Heme oxygenase

SCOPe Domain Sequences for d5kzla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kzla_ a.132.1.0 (A:) automated matches {Leptospira interrogans [TaxId: 173]}
mslatilregtseehkaaessafirsfmkgilekgtyarhleafyyvyesmeeelernkn
nlvlksiyfpelyrknalledlqffygtwkpndhqpsvatqdyvqrirkisetqpellaa
hsyvrylgdlsggqilkkvaaralnlpegkgisfyefpmiqdingfkqnyrtaldslpvn
dsekqsilaeskqvfllnqgifsel

SCOPe Domain Coordinates for d5kzla_:

Click to download the PDB-style file with coordinates for d5kzla_.
(The format of our PDB-style files is described here.)

Timeline for d5kzla_:

  • d5kzla_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27