Lineage for d5gmub_ (5gmu B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011335Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 2011336Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 2011396Family a.130.1.0: automated matches [237401] (1 protein)
    not a true family
  6. 2011397Protein automated matches [237402] (3 species)
    not a true protein
  7. 2293628Species Bacillus subtilis [TaxId:224308] [336929] (2 PDB entries)
  8. 2293669Domain d5gmub_: 5gmu B: [336970]
    automated match to d2d8ea_
    complexed with 7lh, so4

Details for d5gmub_

PDB Entry: 5gmu (more details), 1.8 Å

PDB Description: crystal structure of chorismate mutase like domain of bifunctional dahp synthase of bacillus subtilis in complex with chlorogenic acid
PDB Compounds: (B:) Protein AroA(G)

SCOPe Domain Sequences for d5gmub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gmub_ a.130.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
sntelellrqkadelnlqilklinergnvvkeigkakeaqgvnrfdpvrertmlnniien
ndgpfenstiqhifkeifkaglelqee

SCOPe Domain Coordinates for d5gmub_:

Click to download the PDB-style file with coordinates for d5gmub_.
(The format of our PDB-style files is described here.)

Timeline for d5gmub_:

  • d5gmub_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27