Lineage for d1qssa1 (1qss A:293-422)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) 
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins) Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) 
Species Thermus aquaticus [TaxId:271] [53121] (13 PDB entries) 
Domain d1qssa1: 1qss A:293-422 [33697]
Other proteins in same PDB: d1qssa2
Details for d1qssa1
PDB Entry: 1qss (more details), 2.3 Å
PDB Description: ddgtp-trapped closed ternary complex of the large fragment of dna polymerase i from thermus aquaticus
SCOP Domain Sequences for d1qssa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qssa1 c.55.3.5 (A:293-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus}
aleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeergll
akdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserl
fanlwgrleg
SCOP Domain Coordinates for d1qssa1:
Click to download the PDB-style file with coordinates for d1qssa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qssa1:
- d1qssa1 appears in SCOP 1.57
- d1qssa1 appears in the current release, SCOPe 2.08
View in 3D
