Lineage for d5kz9a_ (5kz9 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1999823Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 1999824Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 1999871Family a.61.1.4: GAG polyprotein M-domain [47848] (2 protein domains)
    the C-terminal helix region is missing(?)
    automatically mapped to Pfam PF02813
  6. 2293660Protein automated matches [336961] (1 species)
    not a true protein
  7. 2293661Species Rous sarcoma virus (strain prague c) [TaxId:11888] [336962] (2 PDB entries)
  8. 2293665Domain d5kz9a_: 5kz9 A: [336966]
    automated match to d1a6sa_

Details for d5kz9a_

PDB Entry: 5kz9 (more details), 2.85 Å

PDB Description: crystal structure of the rous sarcoma virus matrix protein.
PDB Compounds: (A:) Virus Matrix Protein

SCOPe Domain Sequences for d5kz9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kz9a_ a.61.1.4 (A:) automated matches {Rous sarcoma virus (strain prague c) [TaxId: 11888]}
meavikvissacktycgktspskkeigamlsllqkegllmspsdlyspgswdpitaalsq
ramilgksgelktwglvlgalkaareeqvtseqakfwlglgg

SCOPe Domain Coordinates for d5kz9a_:

Click to download the PDB-style file with coordinates for d5kz9a_.
(The format of our PDB-style files is described here.)

Timeline for d5kz9a_:

  • d5kz9a_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27