SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kz9a_ (5kz9 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1999823Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 1999824Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 1999871Family a.61.1.4: GAG polyprotein M-domain [47848] (2 protein domains)
    the C-terminal helix region is missing(?)
    automatically mapped to Pfam PF02813
  6. 2293660Protein automated matches [336961] (1 species)
    not a true protein
  7. 2293661Species Rous sarcoma virus (strain prague c) [TaxId:11888] [336962] (2 PDB entries)
  8. 2293665Domain d5kz9a_: 5kz9 A: [336966]
    automated match to d1a6sa_

Details for d5kz9a_

PDB Entry: 5kz9 (more details), 2.85 Å

PDB Description: crystal structure of the rous sarcoma virus matrix protein.
PDB Compounds: (A:) Virus Matrix Protein

SCOPe Domain Sequences for d5kz9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kz9a_ a.61.1.4 (A:) automated matches {Rous sarcoma virus (strain prague c) [TaxId: 11888]}
meavikvissacktycgktspskkeigamlsllqkegllmspsdlyspgswdpitaalsq
ramilgksgelktwglvlgalkaareeqvtseqakfwlglgg

SCOPe Domain Coordinates for d5kz9a_:

Click to download the PDB-style file with coordinates for d5kz9a_.
(The format of our PDB-style files is described here.)

Timeline for d5kz9a_:

  • d5kz9a_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27