SCOPe 2.06: Domain d5kzaa1: 5kza A:2-92

Lineage for d5kzaa1 (5kza A:2-92)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
   4-5 helices; right-handed superhelix

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families)
   the 5th, C-terminal helix is missing in some of the member structures

5. Family a.61.1.4: GAG polyprotein M-domain [47848] (2 proteins)
   the C-terminal helix region is missing(?)
   automatically mapped to Pfam PF02813

6. Protein automated matches [336961] (1 species)
   not a true protein

7. Species Rous sarcoma virus (strain prague c) [TaxId:11888] [336962] (2 PDB entries)

8. Domain d5kzaa1: 5kza A:2-92 [336964]
   Other proteins in same PDB: d5kzaa2
   automated match to d1a6sa_
   complexed with edo, no3

Details for d5kzaa1

PDB Entry: 5kza, 1.86 Å

PDB Description: crystal structure of the rous sarcoma virus matrix protein (aa 2-102). space group i41

PDB Compounds: (A:) Virus Matrix Protein

SCOPe Domain Sequences for d5kzaa1:

Sequence; same for both SEQRES and ATOM records:

>d5kzaa1 a.61.1.4 (A:2-92) automated matches {Rous sarcoma virus (strain prague c) [TaxId: 11888]}
eavikvissacktycgktspskkeigamlsllqkegllmspsdlyspgswdpitaalsqr
amilgksgelktwglvlgalkaareeqvtse

Timeline for d5kzaa1:

• d5kzaa1 is new in SCOPe 2.06-stable
  
• d5kzaa1 appears in SCOPe 2.07
  
• d5kzaa1 appears in the current release, SCOPe 2.08