Lineage for d5kzaa1 (5kza A:2-92)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1999823Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 1999824Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 1999871Family a.61.1.4: GAG polyprotein M-domain [47848] (2 protein domains)
    the C-terminal helix region is missing(?)
    automatically mapped to Pfam PF02813
  6. 2293660Protein automated matches [336961] (1 species)
    not a true protein
  7. 2293661Species Rous sarcoma virus (strain prague c) [TaxId:11888] [336962] (2 PDB entries)
  8. 2293663Domain d5kzaa1: 5kza A:2-92 [336964]
    Other proteins in same PDB: d5kzaa2
    automated match to d1a6sa_
    complexed with edo, no3

Details for d5kzaa1

PDB Entry: 5kza (more details), 1.86 Å

PDB Description: crystal structure of the rous sarcoma virus matrix protein (aa 2-102). space group i41
PDB Compounds: (A:) Virus Matrix Protein

SCOPe Domain Sequences for d5kzaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kzaa1 a.61.1.4 (A:2-92) automated matches {Rous sarcoma virus (strain prague c) [TaxId: 11888]}
eavikvissacktycgktspskkeigamlsllqkegllmspsdlyspgswdpitaalsqr
amilgksgelktwglvlgalkaareeqvtse

SCOPe Domain Coordinates for d5kzaa1:

Click to download the PDB-style file with coordinates for d5kzaa1.
(The format of our PDB-style files is described here.)

Timeline for d5kzaa1:

  • d5kzaa1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5kzaa2