SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kzaa1 (5kza A:2-92)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1999823Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 1999824Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 1999871Family a.61.1.4: GAG polyprotein M-domain [47848] (2 protein domains)
    the C-terminal helix region is missing(?)
    automatically mapped to Pfam PF02813
  6. 2293660Protein automated matches [336961] (1 species)
    not a true protein
  7. 2293661Species Rous sarcoma virus (strain prague c) [TaxId:11888] [336962] (2 PDB entries)
  8. 2293663Domain d5kzaa1: 5kza A:2-92 [336964]
    Other proteins in same PDB: d5kzaa2
    automated match to d1a6sa_
    complexed with edo, no3

Details for d5kzaa1

PDB Entry: 5kza (more details), 1.86 Å

PDB Description: crystal structure of the rous sarcoma virus matrix protein (aa 2-102). space group i41
PDB Compounds: (A:) Virus Matrix Protein

SCOPe Domain Sequences for d5kzaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kzaa1 a.61.1.4 (A:2-92) automated matches {Rous sarcoma virus (strain prague c) [TaxId: 11888]}
eavikvissacktycgktspskkeigamlsllqkegllmspsdlyspgswdpitaalsqr
amilgksgelktwglvlgalkaareeqvtse

SCOPe Domain Coordinates for d5kzaa1:

Click to download the PDB-style file with coordinates for d5kzaa1.
(The format of our PDB-style files is described here.)

Timeline for d5kzaa1:

  • d5kzaa1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5kzaa2