SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5go2b_ (5go2 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011335Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 2011336Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 2011396Family a.130.1.0: automated matches [237401] (1 protein)
    not a true family
  6. 2011397Protein automated matches [237402] (3 species)
    not a true protein
  7. 2293628Species Bacillus subtilis [TaxId:224308] [336929] (2 PDB entries)
  8. 2293659Domain d5go2b_: 5go2 B: [336960]
    automated match to d2d8ea_
    complexed with cit, so4

Details for d5go2b_

PDB Entry: 5go2 (more details), 1.91 Å

PDB Description: crystal structure of chorismate mutase like domain of bifunctional dahp synthase of bacillus subtilis in complex with citrate
PDB Compounds: (B:) Protein AroA(G)

SCOPe Domain Sequences for d5go2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5go2b_ a.130.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
msntelellrqkadelnlqilklinergnvvkeigkakeaqgvnrfdpvrertmlnniie
nndgpfenstiqhifkeifkaglelqee

SCOPe Domain Coordinates for d5go2b_:

Click to download the PDB-style file with coordinates for d5go2b_.
(The format of our PDB-style files is described here.)

Timeline for d5go2b_:

  • d5go2b_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27