SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hm7b_ (5hm7 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2044115Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2044116Protein automated matches [190437] (52 species)
    not a true protein
  7. 2044265Species Human (Homo sapiens) [TaxId:9606] [187655] (76 PDB entries)
  8. 2293651Domain d5hm7b_: 5hm7 B: [336952]
    automated match to d4v1pa_
    complexed with bme, gol, mg

Details for d5hm7b_

PDB Entry: 5hm7 (more details), 1.93 Å

PDB Description: the intracellular domain of butyrophilin 3a1 protein
PDB Compounds: (B:) Butyrophilin subfamily 3 member A1

SCOPe Domain Sequences for d5hm7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hm7b_ b.29.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erhsaynewkkalfkpadvildpktanpillvsedqrsvqrakepqdlpdnperfnwhyc
vlgcesfisgrhywevevgdrkewhigvcsknvqrkgwvkmtpengfwtmgltdgnkyrt
lteprtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltl
eptalticpa

SCOPe Domain Coordinates for d5hm7b_:

Click to download the PDB-style file with coordinates for d5hm7b_.
(The format of our PDB-style files is described here.)

Timeline for d5hm7b_:

  • d5hm7b_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27