Lineage for d5gnha2 (5gnh A:199-586)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116598Family c.45.1.3: Myotubularin-like phosphatases [102422] (2 protein domains)
    common fold is decorated with additional structures
  6. 2116599Protein Myotubularin-related protein 2, C-terminal domain [102423] (1 species)
  7. 2116600Species Human (Homo sapiens) [TaxId:9606] [102424] (5 PDB entries)
  8. 2293641Domain d5gnha2: 5gnh A:199-586 [336942]
    Other proteins in same PDB: d5gnha1, d5gnhb1
    automated match to d1zvra2
    complexed with po4

Details for d5gnha2

PDB Entry: 5gnh (more details), 2.6 Å

PDB Description: myotubularin-related protein 2
PDB Compounds: (A:) Myotubularin-related protein 2

SCOPe Domain Sequences for d5gnha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gnha2 c.45.1.3 (A:199-586) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
evfpengwklydplleyrrqgipneswritkineryelcdtypallvvpanipdeelkrv
asfrsrgripvlswihpesqatitrcsqpmvgvsgkrskedekylqaimdsnaqshkifi
fdarpsvnavankakgggyesedayqnaelvfldihnihvmreslrklkeivypnieeth
wlsnlesthwlehiklilagalriadkvesgktsvvvhssdgwdrtaqltslamlmldgy
yrtirgfevlvekewlsfghrfqlrvghgdknhadadrspvflqfidcvwqmtrqfptaf
efneyflitildhlysclfgtflcnseqqrgkenlpkrtvslwsyinsqledftnplygs
ysnhvlypvasmrhlelwvgyyirwnpr

SCOPe Domain Coordinates for d5gnha2:

Click to download the PDB-style file with coordinates for d5gnha2.
(The format of our PDB-style files is described here.)

Timeline for d5gnha2:

  • d5gnha2 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5gnha1