SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gnha1 (5gnh A:75-198)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061576Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2061577Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2062083Family b.55.1.8: GRAM domain [101839] (1 protein)
  6. 2062084Protein Myotubularin-related protein 2, N-terminal domain [101840] (1 species)
  7. 2062085Species Human (Homo sapiens) [TaxId:9606] [101841] (5 PDB entries)
  8. 2293636Domain d5gnha1: 5gnh A:75-198 [336937]
    Other proteins in same PDB: d5gnha2, d5gnhb2
    automated match to d1lw3a1
    complexed with po4

Details for d5gnha1

PDB Entry: 5gnh (more details), 2.6 Å

PDB Description: myotubularin-related protein 2
PDB Compounds: (A:) Myotubularin-related protein 2

SCOPe Domain Sequences for d5gnha1:

Sequence, based on SEQRES records: (download)

>d5gnha1 b.55.1.8 (A:75-198) Myotubularin-related protein 2, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
eppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvinr
vekiggassrgensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlplfa
feyk

Sequence, based on observed residues (ATOM records): (download)

>d5gnha1 b.55.1.8 (A:75-198) Myotubularin-related protein 2, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
eppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvinr
vekigensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlplfafeyk

SCOPe Domain Coordinates for d5gnha1:

Click to download the PDB-style file with coordinates for d5gnha1.
(The format of our PDB-style files is described here.)

Timeline for d5gnha1:

  • d5gnha1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5gnha2