SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5go1a_ (5go1 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2173863Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2173864Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 protein domains)
  6. 2174114Protein automated matches [190032] (18 species)
    not a true protein
  7. 2293631Species Leishmania amazonensis [TaxId:5659] [336932] (1 PDB entry)
  8. 2293632Domain d5go1a_: 5go1 A: [336933]
    automated match to d3ngsa_

Details for d5go1a_

PDB Entry: 5go1 (more details), 2.5 Å

PDB Description: structural, functional characterization and discovery of novel inhibitors of leishmania amazonensis nucleoside diphosphatase kinase (ndk)
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d5go1a_:

Sequence, based on SEQRES records: (download)

>d5go1a_ d.58.6.1 (A:) automated matches {Leishmania amazonensis [TaxId: 5659]}
sertfiavkpdgvqrglagevicrferkgyklvalkmlqptteqaeghykdlsskpffpa
lvkyfssgpivcmvwegknvvkggrmllgatnpadshpgtirgdfavdmgrnvchgsdsv
esaereiafwfkadelac

Sequence, based on observed residues (ATOM records): (download)

>d5go1a_ d.58.6.1 (A:) automated matches {Leishmania amazonensis [TaxId: 5659]}
sertfiavkpdgvqrglagevicrferkgyklvalkmlqpsgpivcmvwegknvvkggrm
llgatnpadshpgtirgdfavdmgrnvchgsdsvesaereiafwfkadelac

SCOPe Domain Coordinates for d5go1a_:

Click to download the PDB-style file with coordinates for d5go1a_.
(The format of our PDB-style files is described here.)

Timeline for d5go1a_:

  • d5go1a_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27