Lineage for d5go1a_ (5go1 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2173863Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2173864Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 protein domains)
  6. 2174114Protein automated matches [190032] (18 species)
    not a true protein
  7. 2293631Species Leishmania amazonensis [TaxId:5659] [336932] (1 PDB entry)
  8. 2293632Domain d5go1a_: 5go1 A: [336933]
    automated match to d3ngsa_

Details for d5go1a_

PDB Entry: 5go1 (more details), 2.5 Å

PDB Description: structural, functional characterization and discovery of novel inhibitors of leishmania amazonensis nucleoside diphosphatase kinase (ndk)
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d5go1a_:

Sequence, based on SEQRES records: (download)

>d5go1a_ d.58.6.1 (A:) automated matches {Leishmania amazonensis [TaxId: 5659]}
sertfiavkpdgvqrglagevicrferkgyklvalkmlqptteqaeghykdlsskpffpa
lvkyfssgpivcmvwegknvvkggrmllgatnpadshpgtirgdfavdmgrnvchgsdsv
esaereiafwfkadelac

Sequence, based on observed residues (ATOM records): (download)

>d5go1a_ d.58.6.1 (A:) automated matches {Leishmania amazonensis [TaxId: 5659]}
sertfiavkpdgvqrglagevicrferkgyklvalkmlqpsgpivcmvwegknvvkggrm
llgatnpadshpgtirgdfavdmgrnvchgsdsvesaereiafwfkadelac

SCOPe Domain Coordinates for d5go1a_:

Click to download the PDB-style file with coordinates for d5go1a_.
(The format of our PDB-style files is described here.)

Timeline for d5go1a_:

  • d5go1a_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27