SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5vseb1 (5vse B:917-1190)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2072411Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2073020Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 2073097Family b.85.7.0: automated matches [227191] (1 protein)
    not a true family
  6. 2073098Protein automated matches [226914] (1 species)
    not a true protein
  7. 2073099Species Human (Homo sapiens) [TaxId:9606] [225158] (21 PDB entries)
  8. 2293626Domain d5vseb1: 5vse B:917-1190 [336927]
    Other proteins in same PDB: d5vseb2
    automated match to d3k5ka_
    complexed with 9hg, sam, zn

Details for d5vseb1

PDB Entry: 5vse (more details), 1.6 Å

PDB Description: structure of human g9a set-domain (ehmt2) in complex with inhibitor 17: n~2~-cyclopentyl-6,7-dimethoxy-n~2~-methyl-n~4~-(1- methylpiperidin-4-yl)quinazoline-2,4-diamine
PDB Compounds: (B:) Histone-lysine N-methyltransferase EHMT2

SCOPe Domain Sequences for d5vseb1:

Sequence, based on SEQRES records: (download)

>d5vseb1 b.85.7.0 (B:917-1190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctc
vddcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgi
kvrlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldnkdgev
ycidaryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygd
rfwdikskyftcqcgsekckhsaeaialeqsrla

Sequence, based on observed residues (ATOM records): (download)

>d5vseb1 b.85.7.0 (B:917-1190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctc
vddcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgi
kvrlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldevycid
aryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygdrfwd
ikskyftcqcgsekckhsaeaialeqsrla

SCOPe Domain Coordinates for d5vseb1:

Click to download the PDB-style file with coordinates for d5vseb1.
(The format of our PDB-style files is described here.)

Timeline for d5vseb1:

  • d5vseb1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-19

View in 3D
Domains from same chain:
(mouse over for more information)
d5vseb2
View in 3D
Domains from other chains:
(mouse over for more information)
d5vsea_