Lineage for d5vseb1 (5vse B:917-1190)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2072411Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2073020Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 2073097Family b.85.7.0: automated matches [227191] (1 protein)
    not a true family
  6. 2073098Protein automated matches [226914] (2 species)
    not a true protein
  7. 2073099Species Human (Homo sapiens) [TaxId:9606] [225158] (21 PDB entries)
  8. 2293626Domain d5vseb1: 5vse B:917-1190 [336927]
    Other proteins in same PDB: d5vseb2
    automated match to d3k5ka_
    complexed with 9hg, sam, zn

Details for d5vseb1

PDB Entry: 5vse (more details), 1.6 Å

PDB Description: structure of human g9a set-domain (ehmt2) in complex with inhibitor 17: n~2~-cyclopentyl-6,7-dimethoxy-n~2~-methyl-n~4~-(1- methylpiperidin-4-yl)quinazoline-2,4-diamine
PDB Compounds: (B:) Histone-lysine N-methyltransferase EHMT2

SCOPe Domain Sequences for d5vseb1:

Sequence, based on SEQRES records: (download)

>d5vseb1 b.85.7.0 (B:917-1190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctc
vddcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgi
kvrlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldnkdgev
ycidaryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygd
rfwdikskyftcqcgsekckhsaeaialeqsrla

Sequence, based on observed residues (ATOM records): (download)

>d5vseb1 b.85.7.0 (B:917-1190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctc
vddcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgi
kvrlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldevycid
aryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygdrfwd
ikskyftcqcgsekckhsaeaialeqsrla

SCOPe Domain Coordinates for d5vseb1:

Click to download the PDB-style file with coordinates for d5vseb1.
(The format of our PDB-style files is described here.)

Timeline for d5vseb1:

  • d5vseb1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-19

View in 3D
Domains from same chain:
(mouse over for more information)
d5vseb2
View in 3D
Domains from other chains:
(mouse over for more information)
d5vsea_