Lineage for d5wcma_ (5wcm A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2205699Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2205700Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2205701Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 protein domains)
  6. 2205847Protein automated matches [190079] (9 species)
    not a true protein
  7. 2205874Species Bradyrhizobium japonicum [TaxId:224911] [226051] (3 PDB entries)
  8. 2293625Domain d5wcma_: 5wcm A: [336926]
    automated match to d3lvza_
    complexed with 4nz, zn

Details for d5wcma_

PDB Entry: 5wcm (more details), 1.2 Å

PDB Description: crystal structure of the complex between class b3 beta-lactamase bjp-1 and 4-nitrobenzene-sulfonamide - new refinement
PDB Compounds: (A:) Blr6230 protein

SCOPe Domain Sequences for d5wcma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wcma_ d.157.1.1 (A:) automated matches {Bradyrhizobium japonicum [TaxId: 224911]}
kkwtapfepfqlidniyyvgtdgiavyviktsqglilmdtampqstgmikdniaklgfkv
adiklilnthahldhtggfaeikketgaqlvagerdkplleggyypgdeknedlafpavk
vdravkegdrvtlgdttltahatpghspgctswemtvkdgkedrevlffcsgtvalnrlv
gqptyagivddyratfakakamkidvllgphpevygmqakraemkdgapnpfikpgelvt
yatslsedfdkqlakqtaalekk

SCOPe Domain Coordinates for d5wcma_:

Click to download the PDB-style file with coordinates for d5wcma_.
(The format of our PDB-style files is described here.)

Timeline for d5wcma_:

  • d5wcma_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-19