SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kvuc_ (5kvu C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138632Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2138633Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2138891Family c.77.1.2: Monomeric isocitrate dehydrogenase [82526] (2 protein domains)
    the active site is contained within one subunit between the canonical ICDH fold and a large insert domain that itself is a probable rudiment form of ICDH fold resulted from duplication, domain swapping and deletion
    automatically mapped to Pfam PF03971
  6. 2138898Protein automated matches [190493] (4 species)
    not a true protein
  7. 2293501Species Mycobacterium tuberculosis [TaxId:83332] [336802] (1 PDB entry)
  8. 2293624Domain d5kvuc_: 5kvu C: [336925]
    automated match to d2b0ta_
    complexed with edo, gol, mla, mlt, nap, sin

Details for d5kvuc_

PDB Entry: 5kvu (more details), 2.66 Å

PDB Description: crystal structure of isocitrate dehydrogenase-2 in complex with nadp(+) from mycobacterium tuberculosis
PDB Compounds: (C:) isocitrate dehydrogenase

SCOPe Domain Sequences for d5kvuc_:

Sequence, based on SEQRES records: (download)

>d5kvuc_ c.77.1.2 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qptiiytltdeapllatyaflpivrafaepagikieasdisvaarilaefpdylteeqrv
pdnlaelgrltqlpdtniiklpnisasvpqlvaaikelqdkgyavpdypadpktdqekai
keryarclgsavnpvlrqgnsdrrapkavkeyarkhphsmgewsmasrthvahmrhgdfy
ageksmtldrarnvrmellaksgktivlkpevplddgdvidsmfmskkalcdfyeeqmqd
afetgvmfslhvkatmmkvshpivfghavrifykdafakhqelfddlgvnvnnglsdlys
kieslpasqrdeiiedlhrchehrpelamvdsargisnfhspsdvivdasmpamiraggk
mygadgklkdtkavnpestfsriyqeiinfcktngqfdpttmgtvpnvglmaqqaeeygs
hdktfeipedgvanivdvatgevlltenveagdiwrmcivkdapirdwvklavtrarisg
mpvlfwldpyrphenelikkvktylkdhdtegldiqimsqvrsmrytcerlvrgldtiaa
tgnilrdyltdlfpilelgtsakmlsvvplmagggmyetgaggsapkhvkqlveenhlrw
dslgeflalgagfedigiktgnerakllgktldaaigklldndkspsrktgeldnrgsqf
ylamywaqelaaqtddqqlaehfasladvltknedvivreltevqgepvdiggyyapdsd
mttavmrpsktfnaaleav

Sequence, based on observed residues (ATOM records): (download)

>d5kvuc_ c.77.1.2 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qptiiytltdeapllatyaflpivrafaepagikieasdisvaarilaefpdylteeqrv
pdnlaelgrltqlpdtniiklpnisasvpqlvaaikelqdkgyavpdypadpktdqekai
keryarclgsavnpvlrqgnsdrrapkavkeyarkhphsmgewsmasrthvahmrhgdfy
ageksmtldrarnvrmellaksgktivlkpevplddgdvidsmfmskkalcdfyeeqmqd
afetgvmfslhvkatmpivfghavrifykdafakhqelfddlgvnvnnglsdlyskiesl
pasqrdeiiedlhrchehrpelamvdsargisnfhspsdvivdasmpamiraggkmygad
gklkdtkavnpestfsriyqeiinfcktngqfdpttmgtvpnvglmaqqaeeygshdktf
eipedgvanivdvatgevlltenveagdiwrmcivkdapirdwvklavtrarisgmpvlf
wldpyrphenelikkvktylkdhdtegldiqimsqvrsmrytcerlvrgldtiaatgnil
rdyltdlfpilelgtsakmlsvvplmagggmyetgaggsapkhvkqlveenhlrwdslge
flalgagfedigiktgnerakllgktldaaigklldndkspsrktgeldnrgsqfylamy
waqelaaqtddqqlaehfasladvltknedvivreltevqgepvdiggyyapdsdmttav
mrpsktfnaaleav

SCOPe Domain Coordinates for d5kvuc_:

Click to download the PDB-style file with coordinates for d5kvuc_.
(The format of our PDB-style files is described here.)

Timeline for d5kvuc_:

  • d5kvuc_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-19