Lineage for d5kvuc_ (5kvu C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138632Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2138633Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2138891Family c.77.1.2: Monomeric isocitrate dehydrogenase [82526] (2 protein domains)
    the active site is contained within one subunit between the canonical ICDH fold and a large insert domain that itself is a probable rudiment form of ICDH fold resulted from duplication, domain swapping and deletion
    automatically mapped to Pfam PF03971
  6. 2138898Protein automated matches [190493] (4 species)
    not a true protein
  7. 2293501Species Mycobacterium tuberculosis [TaxId:83332] [336802] (1 PDB entry)
  8. 2293624Domain d5kvuc_: 5kvu C: [336925]
    automated match to d2b0ta_
    complexed with edo, gol, mla, mlt, nap, sin

Details for d5kvuc_

PDB Entry: 5kvu (more details), 2.66 Å

PDB Description: crystal structure of isocitrate dehydrogenase-2 in complex with nadp(+) from mycobacterium tuberculosis
PDB Compounds: (C:) isocitrate dehydrogenase

SCOPe Domain Sequences for d5kvuc_:

Sequence, based on SEQRES records: (download)

>d5kvuc_ c.77.1.2 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qptiiytltdeapllatyaflpivrafaepagikieasdisvaarilaefpdylteeqrv
pdnlaelgrltqlpdtniiklpnisasvpqlvaaikelqdkgyavpdypadpktdqekai
keryarclgsavnpvlrqgnsdrrapkavkeyarkhphsmgewsmasrthvahmrhgdfy
ageksmtldrarnvrmellaksgktivlkpevplddgdvidsmfmskkalcdfyeeqmqd
afetgvmfslhvkatmmkvshpivfghavrifykdafakhqelfddlgvnvnnglsdlys
kieslpasqrdeiiedlhrchehrpelamvdsargisnfhspsdvivdasmpamiraggk
mygadgklkdtkavnpestfsriyqeiinfcktngqfdpttmgtvpnvglmaqqaeeygs
hdktfeipedgvanivdvatgevlltenveagdiwrmcivkdapirdwvklavtrarisg
mpvlfwldpyrphenelikkvktylkdhdtegldiqimsqvrsmrytcerlvrgldtiaa
tgnilrdyltdlfpilelgtsakmlsvvplmagggmyetgaggsapkhvkqlveenhlrw
dslgeflalgagfedigiktgnerakllgktldaaigklldndkspsrktgeldnrgsqf
ylamywaqelaaqtddqqlaehfasladvltknedvivreltevqgepvdiggyyapdsd
mttavmrpsktfnaaleav

Sequence, based on observed residues (ATOM records): (download)

>d5kvuc_ c.77.1.2 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
qptiiytltdeapllatyaflpivrafaepagikieasdisvaarilaefpdylteeqrv
pdnlaelgrltqlpdtniiklpnisasvpqlvaaikelqdkgyavpdypadpktdqekai
keryarclgsavnpvlrqgnsdrrapkavkeyarkhphsmgewsmasrthvahmrhgdfy
ageksmtldrarnvrmellaksgktivlkpevplddgdvidsmfmskkalcdfyeeqmqd
afetgvmfslhvkatmpivfghavrifykdafakhqelfddlgvnvnnglsdlyskiesl
pasqrdeiiedlhrchehrpelamvdsargisnfhspsdvivdasmpamiraggkmygad
gklkdtkavnpestfsriyqeiinfcktngqfdpttmgtvpnvglmaqqaeeygshdktf
eipedgvanivdvatgevlltenveagdiwrmcivkdapirdwvklavtrarisgmpvlf
wldpyrphenelikkvktylkdhdtegldiqimsqvrsmrytcerlvrgldtiaatgnil
rdyltdlfpilelgtsakmlsvvplmagggmyetgaggsapkhvkqlveenhlrwdslge
flalgagfedigiktgnerakllgktldaaigklldndkspsrktgeldnrgsqfylamy
waqelaaqtddqqlaehfasladvltknedvivreltevqgepvdiggyyapdsdmttav
mrpsktfnaaleav

SCOPe Domain Coordinates for d5kvuc_:

Click to download the PDB-style file with coordinates for d5kvuc_.
(The format of our PDB-style files is described here.)

Timeline for d5kvuc_:

  • d5kvuc_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-19