Lineage for d5gmrd_ (5gmr D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2153568Species Uncultured bacterium [TaxId:77133] [196706] (23 PDB entries)
  8. 2153601Domain d5gmrd_: 5gmr D: [336920]
    automated match to d1evqa_
    mutant

Details for d5gmrd_

PDB Entry: 5gmr (more details), 1.8 Å

PDB Description: crystal structure of the mutant m3+s202w/i203f of the esterase e40
PDB Compounds: (D:) esterase

SCOPe Domain Sequences for d5gmrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gmrd_ c.69.1.0 (D:) automated matches {Uncultured bacterium [TaxId: 77133]}
kspeldrvigmireraatpykhlstdddrrlyetmlgsmpldddiqterlgvngvpaewi
yapgarddqvflylhgggyvigsmrthrvmlshiaraagcrvlgldyrlapetpfpapve
dtvaayrwllahgydpsrialggdsaggglvvaalvalryigeplpaagvclspwidmea
tgesfttnatmdpsvnkervmwfaalylggknpqaplasplyadlqglppllvqvggiet
llddaralttrakaagvdadlevwddmphvwqhfapilpegkqaiarigeflrkqig

SCOPe Domain Coordinates for d5gmrd_:

Click to download the PDB-style file with coordinates for d5gmrd_.
(The format of our PDB-style files is described here.)

Timeline for d5gmrd_: