Lineage for d2kzma1 (2kzm A:324-518)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) 
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins) Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) 
Species Escherichia coli [TaxId:562] [53120] (14 PDB entries) 
Domain d2kzma1: 2kzm A:324-518 [33690]
Other proteins in same PDB: d2kzma2
Details for d2kzma1
PDB Entry: 2kzm (more details), 2.6 Å
PDB Description: klenow fragment with normal substrate and zinc and manganese
SCOP Domain Sequences for d2kzma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kzma1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli}
misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
vtlqlhlkmwpdlqk
SCOP Domain Coordinates for d2kzma1:
Click to download the PDB-style file with coordinates for d2kzma1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2kzma1:
- d2kzma1 first appeared (with stable ids) in SCOP 1.55
- d2kzma1 appears in SCOP 1.59
- d2kzma1 appears in SCOP 1.63
- d2kzma1 appears in the current release, SCOPe 2.08
View in 3D
