Lineage for d5wdsb1 (5wds B:1-167)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (144 species)
    not a true protein
  7. 2452804Species Salpingoeca rosetta [TaxId:28009] [336884] (2 PDB entries)
  8. 2452808Domain d5wdsb1: 5wds B:1-167 [336891]
    Other proteins in same PDB: d5wdsa2, d5wdsb2
    automated match to d4ku4b_
    complexed with gdp, gol, mg

Details for d5wdsb1

PDB Entry: 5wds (more details), 1.85 Å

PDB Description: choanoflagellate salpingoeca rosetta ras with gdp bound
PDB Compounds: (B:) Ras protein

SCOPe Domain Sequences for d5wdsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wdsb1 c.37.1.0 (B:1-167) automated matches {Salpingoeca rosetta [TaxId: 28009]}
mteyrlvvvgtggvgksaltiqliqqhfvteydptiedsyrkhvsiddeaclldildtag
qedysamrdqymrtgegflcvysidsqqsldeihsfreqilrvkdqdevpmilvgnkcdl
eehrevsteagqavaksysipfmetsakkrinveeafyqlvreirky

SCOPe Domain Coordinates for d5wdsb1:

Click to download the PDB-style file with coordinates for d5wdsb1.
(The format of our PDB-style files is described here.)

Timeline for d5wdsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5wdsb2