Lineage for d2kzza1 (2kzz A:324-518)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 181999Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 182249Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) (S)
  5. 182436Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins)
  6. 182459Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
  7. 182465Species Escherichia coli [TaxId:562] [53120] (14 PDB entries)
  8. 182474Domain d2kzza1: 2kzz A:324-518 [33689]
    Other proteins in same PDB: d2kzza2

Details for d2kzza1

PDB Entry: 2kzz (more details), 2.25 Å

PDB Description: klenow fragment with normal substrate and zinc only

SCOP Domain Sequences for d2kzza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kzza1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli}
misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
vtlqlhlkmwpdlqk

SCOP Domain Coordinates for d2kzza1:

Click to download the PDB-style file with coordinates for d2kzza1.
(The format of our PDB-style files is described here.)

Timeline for d2kzza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2kzza2