SCOPe 2.06: Domain d5wdrb_: 5wdr B:

Lineage for d5wdrb_ (5wdr B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Salpingoeca rosetta [TaxId:28009] [336884] (2 PDB entries)

8. Domain d5wdrb_: 5wdr B: [336886]
   automated match to d4ku4b_
   complexed with gnp, mg, na

Details for d5wdrb_

PDB Entry: 5wdr, 1.6 Å

PDB Description: choanoflagellate salpingoeca rosetta ras with gmp-pnp

PDB Compounds: (B:) Ras protein

SCOPe Domain Sequences for d5wdrb_:

Sequence; same for both SEQRES and ATOM records:

>d5wdrb_ c.37.1.0 (B:) automated matches {Salpingoeca rosetta [TaxId: 28009]}
mteyrlvvvgtggvgksaltiqliqqhfvteydptiedsyrkhvsiddeaclldildtag
qedysamrdqymrtgegflcvysidsqqsldeihsfreqilrvkdqdevpmilvgnkcdl
eehrevsteagqavaksysipfmetsakkrinveeafyqlvreirky

Timeline for d5wdrb_:

• d5wdrb_ is new in SCOPe 2.06-stable
  
• d5wdrb_ appears in SCOPe 2.07
  
• d5wdrb_ appears in the current release, SCOPe 2.08