![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) ![]() |
![]() | Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins) |
![]() | Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [53120] (14 PDB entries) |
![]() | Domain d1d9da1: 1d9d A:324-518 [33688] Other proteins in same PDB: d1d9da2 |
PDB Entry: 1d9d (more details), 2.18 Å
SCOP Domain Sequences for d1d9da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d9da1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli} misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad vtlqlhlkmwpdlqk
Timeline for d1d9da1: