Lineage for d5vsea_ (5vse A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818606Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
    Pfam PF00856
  5. 2818685Family b.85.7.0: automated matches [227191] (1 protein)
    not a true family
  6. 2818686Protein automated matches [226914] (2 species)
    not a true protein
  7. 2818687Species Human (Homo sapiens) [TaxId:9606] [225158] (28 PDB entries)
  8. 2818703Domain d5vsea_: 5vse A: [336870]
    Other proteins in same PDB: d5vseb2
    automated match to d3k5ka_
    complexed with 9hg, sam, zn

Details for d5vsea_

PDB Entry: 5vse (more details), 1.6 Å

PDB Description: structure of human g9a set-domain (ehmt2) in complex with inhibitor 17: n~2~-cyclopentyl-6,7-dimethoxy-n~2~-methyl-n~4~-(1- methylpiperidin-4-yl)quinazoline-2,4-diamine
PDB Compounds: (A:) Histone-lysine N-methyltransferase EHMT2

SCOPe Domain Sequences for d5vsea_:

Sequence, based on SEQRES records: (download)

>d5vsea_ b.85.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctcvd
dcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgikv
rlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldnkdgevyc
idaryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygdrf
wdikskyftcqcgsekckhsaeaialeqsrla

Sequence, based on observed residues (ATOM records): (download)

>d5vsea_ b.85.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekiicrdvargyenvpipcvngvdgepcpedykyisencetstmnidrnithlqhctcvd
dcsssnclcgqlsircwydkdgrllqefnkiepplifecnqacscwrncknrvvqsgikv
rlqlyrtakmgwgvralqtipqgtficeyvgelisdaeadvreddsylfdldnevycida
ryygnisrfinhlcdpniipvrvfmlhqdlrfpriaffssrdirtgeelgfdygdrfwdi
kskyftcqcgsekckhsaeaialeqsrla

SCOPe Domain Coordinates for d5vsea_:

Click to download the PDB-style file with coordinates for d5vsea_.
(The format of our PDB-style files is described here.)

Timeline for d5vsea_: