Class b: All beta proteins [48724] (180 folds) |
Fold b.77: beta-Prism I [51091] (4 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) |
Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins) |
Protein automated matches [190387] (4 species) not a true protein |
Species Artocarpus altilis [TaxId:194251] [336810] (3 PDB entries) |
Domain d5tqzd_: 5tqz D: [336869] automated match to d1j4ta_ complexed with glc |
PDB Entry: 5tqz (more details), 1.6 Å
SCOPe Domain Sequences for d5tqzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tqzd_ b.77.3.1 (D:) automated matches {Artocarpus altilis [TaxId: 194251]} masqtitvgpwggpggnewddgsytgiriielsykeaigsfsviydlngepfsgskhtsk lpytnvkielqfpeeflvsvsgytapfsslatrtpvvrslkfktnkgrtfgpygeedgty fnlpienglvvgfkgrtgdlldaigvhmal
Timeline for d5tqzd_: