Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (39 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:2234] [186755] (3 PDB entries) |
Domain d5v5ke_: 5v5k E: [336859] automated match to d1s3qj_ mutant |
PDB Entry: 5v5k (more details), 3.08 Å
SCOPe Domain Sequences for d5v5ke_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v5ke_ a.25.1.0 (E:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf vsrrggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
Timeline for d5v5ke_: