Lineage for d1krpa1 (1krp A:324-518)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 586264Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 586646Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) (S)
    consists of one domain of this fold
  5. 586884Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (10 proteins)
    contains Pfam 00929
  6. 586925Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 586960Species Escherichia coli [TaxId:562] [53120] (14 PDB entries)
  8. 586965Domain d1krpa1: 1krp A:324-518 [33685]
    Other proteins in same PDB: d1krpa2
    protein/DNA complex; complexed with pst, zn; mutant

Details for d1krpa1

PDB Entry: 1krp (more details), 2.2 Å

PDB Description: dna polymerase i klenow fragment (e.c.2.7.7.7) mutant/dna complex

SCOP Domain Sequences for d1krpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1krpa1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli}
misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
vtlqlhlkmwpdlqk

SCOP Domain Coordinates for d1krpa1:

Click to download the PDB-style file with coordinates for d1krpa1.
(The format of our PDB-style files is described here.)

Timeline for d1krpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1krpa2